PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G26660.1
Common NameATMYB86, F21E10.4, MYB86
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 352aa    MW: 39790.3 Da    PI: 8.0361
Description myb domain protein 86
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G26660.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
      AT5G26660.1 14 KGLWSPEEDEKLLNYITRHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding49.97.3e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia +++ gRt++++k++w++
      AT5G26660.1  67 RGAFSQDEESLIIELHAALGNR-WSQIATRLP-GRTDNEIKNFWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.515961IPR017930Myb domain
SuperFamilySSF466894.03E-2912108IPR009057Homeodomain-like
SMARTSM007177.6E-131363IPR001005SANT/Myb domain
PfamPF002494.4E-161461IPR001005SANT/Myb domain
CDDcd001676.84E-111761No hitNo description
PROSITE profilePS5129425.90662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-2665116IPR009057Homeodomain-like
SMARTSM007172.7E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1467111IPR001005SANT/Myb domain
CDDcd001676.67E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRHSCCFKQ KLRKGLWSPE EDEKLLNYIT RHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEESLIIE LHAALGNRWS QIATRLPGRT DNEIKNFWNS CLKKKLRRKG  120
IDPTTHKPLI TNELQSLNVI DQKLTSSEVV KSTGSINNLH DQSMVVSSQQ GPWWFPANTT  180
TTNQNSAFCF SSSNTTTVSD QIVSLISSMS TSSSPTPMTS NFSPAPNNWE QLNYCNTVPS  240
QSNSIYSAFF GNQYTEASQT MNNNNPLVDQ HHHHQDMKSW ASEILHYTEH NQSSETVIEA  300
EVKPDIANYY WRSASSSSSP NQEAATLLHD ANVEVYGKNL QKLNNMVFDQ SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.2270.0leaf| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865259240.0
Genevisible246844_at0.0
Expression AtlasAT5G26660-
AtGenExpressAT5G26660-
ATTED-IIAT5G26660-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, flowers and seeds. Weakly expressed in leaves and roots. {ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
TAIRa MYB gene encodes a transcriptional repressor of the C4H gene which is involved in the biosynthesis of sinapate esters.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G26660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G22370(A)
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8LPH6
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G26660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0997770.0AY099777.1 Arabidopsis thaliana transcription factor ATMYB4 (At5g26655) mRNA, complete cds.
GenBankAY5196290.0AY519629.1 Arabidopsis thaliana MYB transcription factor (At5g26660) mRNA, complete cds.
GenBankBT0087400.0BT008740.1 Arabidopsis thaliana At5g26655 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850879.10.0transcription factor MYB86
SwissprotQ8LPH60.0MYB86_ARATH; Transcription factor MYB86
TrEMBLD7M5B70.0D7M5B7_ARALL; ATMYB4
STRINGAT5G26660.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Jin H, et al.
    Transcriptional repression by AtMYB4 controls production of UV-protecting sunscreens in Arabidopsis.
    EMBO J., 2000. 19(22): p. 6150-61
    [PMID:11080161]
  2. Hemm MR,Herrmann KM,Chapple C
    AtMYB4: a transcription factor general in the battle against UV.
    Trends Plant Sci., 2001. 6(4): p. 135-6
    [PMID:11286899]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Shin B, et al.
    AtMYB21, a gene encoding a flower-specific transcription factor, is regulated by COP1.
    Plant J., 2002. 30(1): p. 23-32
    [PMID:11967090]
  5. Kreps JA, et al.
    Transcriptome changes for Arabidopsis in response to salt, osmotic, and cold stress.
    Plant Physiol., 2002. 130(4): p. 2129-41
    [PMID:12481097]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Xiang X,Cao JS,Ye WZ,Cui HM,Yu JN
    [Molecular cloning and characterization of BcMYBogu, a novel member of the MYB family involved in OguCMS in Brassica campestris ssp. chinensis].
    Yi Chuan, 2007. 29(5): p. 621-8
    [PMID:17548334]
  10. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  11. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  13. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]